Lineage for d3bz1a_ (3bz1 A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632594Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2632595Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2632596Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2632815Protein automated matches [190224] (14 species)
    not a true protein
  7. 2632939Species Thermosynechococcus elongatus [TaxId:32046] [188744] (2 PDB entries)
  8. 2632942Domain d3bz1a_: 3bz1 A: [172942]
    Other proteins in same PDB: d3bz1b_, d3bz1c_, d3bz1e_, d3bz1f_, d3bz1h_, d3bz1i_, d3bz1j_, d3bz1k_, d3bz1l_, d3bz1m_, d3bz1o_, d3bz1t_, d3bz1u_, d3bz1v_, d3bz1x_, d3bz1z_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz1a_

PDB Entry: 3bz1 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 1 of 2). This file contains first monomer of PSII dimer
PDB Compounds: (A:) Photosystem Q(B) protein

SCOPe Domain Sequences for d3bz1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz1a_ f.26.1.1 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]}
sanlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsg
sllygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgr
qwelsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqae
hnilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyniv
aahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvida
kgnvintwadiinranlgmevmhernahnfpldla

SCOPe Domain Coordinates for d3bz1a_:

Click to download the PDB-style file with coordinates for d3bz1a_.
(The format of our PDB-style files is described here.)

Timeline for d3bz1a_: