SCOPe 2.02: Domain d3bytg_: 3byt G:

Lineage for d3bytg_ (3byt G:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (22 PDB entries)

8. Domain d3bytg_: 3byt G: [172938]
   automated match to d2aq3a1

Details for d3bytg_

PDB Entry: 3byt, 2.3 Å

PDB Description: A complex between a variant of staphylococcal enterotoxin C3 and the variable domain of the murine T cell receptor beta chain 8.2

PDB Compounds: (G:) T cell receptor beta chain 8.2

SCOPe Domain Sequences for d3bytg_:

Sequence; same for both SEQRES and ATOM records:

>d3bytg_ b.1.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl

Timeline for d3bytg_:

• d3bytg_ first appeared in SCOPe 2.01
  
• d3bytg_ appears in SCOPe 2.03
  
• d3bytg_ appears in the current release, SCOPe 2.08