Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
Protein automated matches [190161] (19 species) not a true protein |
Species Klebsiella oxytoca [TaxId:571] [188743] (1 PDB entry) |
Domain d3byda_: 3byd A: [172933] automated match to d1iyqa_ complexed with act, so4 |
PDB Entry: 3byd (more details), 1.93 Å
SCOPe Domain Sequences for d3byda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3byda_ e.3.1.1 (A:) automated matches {Klebsiella oxytoca [TaxId: 571]} daiqqkladlekrsggrlgvalintaddsqtlyrgderfamcstgkvmaaaavlkqsesn pevvnkrleikksdlvvwspitekhlqsgmtlaelsaaalqysdntamnkmisylggpek vtafaqsigdvtfrldrtepalnsaipgdkrdtttplamaeslrkltlgnalgeqqraql vtwlkgnttggqsiraglpaswavgdktgagdygttndiaviwpenhaplvlvtyftqpq qdaksrkevlaaaakivtegl
Timeline for d3byda_: