Lineage for d3byda_ (3byd A:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690900Protein automated matches [190161] (19 species)
    not a true protein
  7. 1691034Species Klebsiella oxytoca [TaxId:571] [188743] (1 PDB entry)
  8. 1691035Domain d3byda_: 3byd A: [172933]
    automated match to d1iyqa_
    complexed with act, so4

Details for d3byda_

PDB Entry: 3byd (more details), 1.93 Å

PDB Description: crystal structure of beta-lactamase oxy-1-1 from klebsiella oxytoca
PDB Compounds: (A:) Beta-lactamase OXY-1

SCOPe Domain Sequences for d3byda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3byda_ e.3.1.1 (A:) automated matches {Klebsiella oxytoca [TaxId: 571]}
daiqqkladlekrsggrlgvalintaddsqtlyrgderfamcstgkvmaaaavlkqsesn
pevvnkrleikksdlvvwspitekhlqsgmtlaelsaaalqysdntamnkmisylggpek
vtafaqsigdvtfrldrtepalnsaipgdkrdtttplamaeslrkltlgnalgeqqraql
vtwlkgnttggqsiraglpaswavgdktgagdygttndiaviwpenhaplvlvtyftqpq
qdaksrkevlaaaakivtegl

SCOPe Domain Coordinates for d3byda_:

Click to download the PDB-style file with coordinates for d3byda_.
(The format of our PDB-style files is described here.)

Timeline for d3byda_: