Class a: All alpha proteins [46456] (218 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (10 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (23 proteins) Duplication: made with two pairs of EF-hands |
Protein Calmodulin [47516] (10 species) |
Species African frog (Xenopus laevis) [TaxId:8355] [47521] (10 PDB entries) |
Domain d1f71a_: 1f71 A: [17289] C-terminal domain |
PDB Entry: 1f71 (more details)
SCOP Domain Sequences for d1f71a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f71a_ a.39.1.5 (A:) Calmodulin {African frog (Xenopus laevis)} eeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvnyeef vqmmtak
Timeline for d1f71a_: