Class b: All beta proteins [48724] (174 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
Protein automated matches [190914] (4 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188389] (1 PDB entry) |
Domain d3bw1b_: 3bw1 B: [172873] automated match to d1i81d_ complexed with mpd, so4 |
PDB Entry: 3bw1 (more details), 2.5 Å
SCOPe Domain Sequences for d3bw1b_:
Sequence, based on SEQRES records: (download)
>d3bw1b_ b.38.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} hhmetpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnneelse serrcemvfirgdtvtlistpsedddgavei
>d3bw1b_ b.38.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} hhmetpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnneelse serrcemvfirgdtvtlistpsavei
Timeline for d3bw1b_: