Lineage for d3bvsa_ (3bvs A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1500528Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 1501071Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 1501072Protein automated matches [190220] (10 species)
    not a true protein
  7. 1501076Species Bacillus cereus [TaxId:1396] [188492] (1 PDB entry)
  8. 1501077Domain d3bvsa_: 3bvs A: [172871]
    automated match to d2b6ca1

Details for d3bvsa_

PDB Entry: 3bvs (more details), 2.1 Å

PDB Description: Crystal Structure of Bacillus cereus Alkylpurine DNA Glycosylase AlkD
PDB Compounds: (A:) Alkylpurine DNA Glycosylase AlkD

SCOPe Domain Sequences for d3bvsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bvsa_ a.118.1.0 (A:) automated matches {Bacillus cereus [TaxId: 1396]}
vpmhpfvkalqehftahqnpekaepmarymknhflflgiqtperrqllkdiiqihtlpdq
kdfqiiirelwdlperefqaaaldimqkykkhinethipfleelivtkswwdsvdsivpt
flgdiflkhpelisayipkwiasdniwlqraailfqlkykqkmdeellfwiigqlhsske
ffiqkaigwvlreyaktnpdvvweyvqnnelaplskreaikhikqny

SCOPe Domain Coordinates for d3bvsa_:

Click to download the PDB-style file with coordinates for d3bvsa_.
(The format of our PDB-style files is described here.)

Timeline for d3bvsa_: