Lineage for d3bvlc1 (3bvl C:1-166)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2702486Species Helicobacter pylori [TaxId:210] [188725] (5 PDB entries)
  8. 2702501Domain d3bvlc1: 3bvl C:1-166 [172865]
    Other proteins in same PDB: d3bvla2, d3bvlb2, d3bvlc2, d3bvld2, d3bvle2, d3bvlf2
    automated match to d1krqa_
    complexed with fe, gol

Details for d3bvlc1

PDB Entry: 3bvl (more details), 1.8 Å

PDB Description: Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin
PDB Compounds: (C:) Ferritin

SCOPe Domain Sequences for d3bvlc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bvlc1 a.25.1.1 (C:1-166) automated matches {Helicobacter pylori [TaxId: 210]}
mlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyehakkliif
lnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfnfl
qwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk

SCOPe Domain Coordinates for d3bvlc1:

Click to download the PDB-style file with coordinates for d3bvlc1.
(The format of our PDB-style files is described here.)

Timeline for d3bvlc1: