SCOPe 2.03: Domain d3clna_: 3cln A:

Lineage for d3clna_ (3cln A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calmodulin [47516] (12 species)

7. Species Rat (Rattus rattus) [TaxId:10117] [47519] (1 PDB entry)
   Uniprot P62161

8. Domain d3clna_: 3cln A: [17286]
   complexed with ca

Details for d3clna_

PDB Entry: 3cln, 2.2 Å

PDB Description: structure of calmodulin refined at 2.2 angstroms resolution

PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d3clna_:

Sequence; same for both SEQRES and ATOM records:

>d3clna_ a.39.1.5 (A:) Calmodulin {Rat (Rattus rattus) [TaxId: 10117]}
teeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngtid
fpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdem
ireanidgdgqvnyeefvqmmta

Timeline for d3clna_:

• d3clna_ first appeared (with stable ids) in SCOP 1.55, called d3cln__
  
• d3clna_ appears in SCOPe 2.02
  
• d3clna_ appears in SCOPe 2.04
  
• d3clna_ appears in the current release, SCOPe 2.08