Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (18 species) not a true protein |
Species Helicobacter pylori [TaxId:210] [188725] (5 PDB entries) |
Domain d3bvkb_: 3bvk B: [172858] automated match to d1krqa_ complexed with fe, gol |
PDB Entry: 3bvk (more details), 1.5 Å
SCOPe Domain Sequences for d3bvkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bvkb_ a.25.1.1 (B:) automated matches {Helicobacter pylori [TaxId: 210]} hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
Timeline for d3bvkb_: