Lineage for d3bvff_ (3bvf F:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1484439Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1485319Protein automated matches [190041] (24 species)
    not a true protein
  7. 1485502Species Helicobacter pylori [TaxId:210] [188725] (5 PDB entries)
  8. 1485508Domain d3bvff_: 3bvf F: [172850]
    automated match to d1krqa_
    complexed with fe, gol, ipa

Details for d3bvff_

PDB Entry: 3bvf (more details), 1.5 Å

PDB Description: Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin
PDB Compounds: (F:) Ferritin

SCOPe Domain Sequences for d3bvff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bvff_ a.25.1.1 (F:) automated matches {Helicobacter pylori [TaxId: 210]}
hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh
atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk

SCOPe Domain Coordinates for d3bvff_:

Click to download the PDB-style file with coordinates for d3bvff_.
(The format of our PDB-style files is described here.)

Timeline for d3bvff_: