Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (21 species) not a true protein |
Species Helicobacter pylori [TaxId:210] [188725] (5 PDB entries) |
Domain d3bvfe_: 3bvf E: [172849] automated match to d1krqa_ complexed with fe, gol, ipa |
PDB Entry: 3bvf (more details), 1.5 Å
SCOPe Domain Sequences for d3bvfe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bvfe_ a.25.1.1 (E:) automated matches {Helicobacter pylori [TaxId: 210]} hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
Timeline for d3bvfe_: