SCOPe 2.08: Domain d3bvfb1: 3bvf B:1-166

Lineage for d3bvfb1 (3bvf B:1-166)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (34 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [188725] (5 PDB entries)

8. Domain d3bvfb1: 3bvf B:1-166 [172846]
   Other proteins in same PDB: d3bvfa2, d3bvfb2, d3bvfc2, d3bvfd2, d3bvfe2, d3bvff2
   automated match to d1krqa_
   complexed with fe, gol, ipa

Details for d3bvfb1

PDB Entry: 3bvf, 1.5 Å

PDB Description: Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin

PDB Compounds: (B:) Ferritin

SCOPe Domain Sequences for d3bvfb1:

Sequence; same for both SEQRES and ATOM records:

>d3bvfb1 a.25.1.1 (B:1-166) automated matches {Helicobacter pylori [TaxId: 210]}
mlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyehakkliif
lnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfnfl
qwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk

Timeline for d3bvfb1:

• d3bvfb1 first appeared in SCOPe 2.01, called d3bvfb_
  
• d3bvfb1 appears in SCOPe 2.07