SCOPe 2.08: Domain d3bvef1: 3bve F:1-167

Lineage for d3bvef1 (3bve F:1-167)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (34 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [188725] (5 PDB entries)

8. Domain d3bvef1: 3bve F:1-167 [172844]
   Other proteins in same PDB: d3bvea2, d3bveb2, d3bvec2, d3bved2, d3bvee2, d3bvef2
   automated match to d1krqa_
   complexed with gol

Details for d3bvef1

PDB Entry: 3bve, 1.8 Å

PDB Description: Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin

PDB Compounds: (F:) Ferritin

SCOPe Domain Sequences for d3bvef1:

Sequence; same for both SEQRES and ATOM records:

>d3bvef1 a.25.1.1 (F:1-167) automated matches {Helicobacter pylori [TaxId: 210]}
mlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyehakkliif
lnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfnfl
qwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrks

Timeline for d3bvef1:

• d3bvef1 first appeared in SCOPe 2.01, called d3bvef_
  
• d3bvef1 appears in SCOPe 2.07