Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein Hemagglutinin [49824] (22 species) includes rudiment esterase domain |
Species Influenza B virus [TaxId:11520] [188441] (4 PDB entries) |
Domain d3bt6a_: 3bt6 A: [172824] Other proteins in same PDB: d3bt6b_ automated match to d2fk0a1 complexed with nag, so4 |
PDB Entry: 3bt6 (more details), 2.8 Å
SCOPe Domain Sequences for d3bt6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bt6a_ b.19.1.2 (A:) Hemagglutinin {Influenza B virus [TaxId: 11520]} drictgitssnsphvvktatqgevnvtgvipltttptkshfanlkgtqtrgklcpnclnc tdldvalgrpkcmgtipsakasilhevkpvtsgcfpimhdrtkirqlpnllrgyenirls arnvtnaetapggpyivgtsgscpnvtngngffatmawavpknktatnpltvevpyictk gedqitvwgfhsddetqmvklygdskpqkftssangvtthyvsqiggfpnqaedeglpqs grivvdymvqkpgktgtiayqrgvllpqkvwcasgrskvikgslpligeadclhekyggl nkskpyytgehakaigncpiwvktplklangtkyrppakllk
Timeline for d3bt6a_: