Lineage for d1cmg__ (1cmg -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47621Family a.39.1.5: Calmodulin-like [47502] (15 proteins)
  6. 47648Protein Calmodulin [47516] (7 species)
  7. 47665Species Cow (Bos taurus) [TaxId:9913] [47518] (13 PDB entries)
  8. 47683Domain d1cmg__: 1cmg - [17282]

Details for d1cmg__

PDB Entry: 1cmg (more details)

PDB Description: nmr solution structure of calcium-loaded calmodulin carboxy-terminal domain

SCOP Domain Sequences for d1cmg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cmg__ a.39.1.5 (-) Calmodulin {Cow (Bos taurus)}
mkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgq
vnyeefvqmmtak

SCOP Domain Coordinates for d1cmg__:

Click to download the PDB-style file with coordinates for d1cmg__.
(The format of our PDB-style files is described here.)

Timeline for d1cmg__: