Class b: All beta proteins [48724] (177 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (37 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187995] (2 PDB entries) |
Domain d3bn6a_: 3bn6 A: [172716] automated match to d1czva_ |
PDB Entry: 3bn6 (more details), 1.67 Å
SCOPe Domain Sequences for d3bn6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bn6a_ b.18.1.0 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} cteplglkdntipnkqitassyyktwglsafswfpyyarldnqgkfnawtaqtnsasewl qidlgsqkrvtgiitqgardfghiqyvaayrvaygddgvtwteykdpgaseskifpgnmd nnshkknifetpfqarfvriqpvawhnritlrvellgc
Timeline for d3bn6a_: