Lineage for d3bn6a_ (3bn6 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046279Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2046280Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2047120Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2047121Protein automated matches [190770] (37 species)
    not a true protein
  7. 2047208Species Cow (Bos taurus) [TaxId:9913] [187995] (2 PDB entries)
  8. 2047209Domain d3bn6a_: 3bn6 A: [172716]
    automated match to d1czva_

Details for d3bn6a_

PDB Entry: 3bn6 (more details), 1.67 Å

PDB Description: crystal structure of the c2 domain of bovine lactadherin at 1.67 angstrom resolution
PDB Compounds: (A:) Lactadherin

SCOPe Domain Sequences for d3bn6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bn6a_ b.18.1.0 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
cteplglkdntipnkqitassyyktwglsafswfpyyarldnqgkfnawtaqtnsasewl
qidlgsqkrvtgiitqgardfghiqyvaayrvaygddgvtwteykdpgaseskifpgnmd
nnshkknifetpfqarfvriqpvawhnritlrvellgc

SCOPe Domain Coordinates for d3bn6a_:

Click to download the PDB-style file with coordinates for d3bn6a_.
(The format of our PDB-style files is described here.)

Timeline for d3bn6a_: