Lineage for d3bknl_ (3bkn L:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1084172Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1084173Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1085586Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1085587Protein automated matches [190036] (15 species)
    not a true protein
  7. 1085625Species Mycobacterium smegmatis [TaxId:246196] [188322] (2 PDB entries)
  8. 1085641Domain d3bknl_: 3bkn L: [172692]
    automated match to d1jgca_
    complexed with epe, hem, mg, zn

Details for d3bknl_

PDB Entry: 3bkn (more details), 2.72 Å

PDB Description: The structure of Mycobacterial bacterioferritin
PDB Compounds: (L:) bacterioferritin

SCOPe Domain Sequences for d3bknl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bknl_ a.25.1.0 (L:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
mqgdpdvlkllneqltseltainqyflhskmqdnwgftelaehtraesfeemrhaetitd
rillldglpnyqrlfslrvgqtlreqfeadlaieyevlerlkpgivlcrekqdatsarll
eqiladeethidyletqlqlmdklgdalyaaqcvsrppgsa

SCOPe Domain Coordinates for d3bknl_:

Click to download the PDB-style file with coordinates for d3bknl_.
(The format of our PDB-style files is described here.)

Timeline for d3bknl_: