Lineage for d3bkna_ (3bkn A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1991631Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1991632Protein automated matches [190036] (39 species)
    not a true protein
  7. 1991845Species Mycobacterium smegmatis [TaxId:246196] [188322] (14 PDB entries)
  8. 1991866Domain d3bkna_: 3bkn A: [172681]
    automated match to d1jgca_
    complexed with epe, hem, mg, zn

Details for d3bkna_

PDB Entry: 3bkn (more details), 2.72 Å

PDB Description: The structure of Mycobacterial bacterioferritin
PDB Compounds: (A:) bacterioferritin

SCOPe Domain Sequences for d3bkna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bkna_ a.25.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
mqgdpdvlkllneqltseltainqyflhskmqdnwgftelaehtraesfeemrhaetitd
rillldglpnyqrlfslrvgqtlreqfeadlaieyevlerlkpgivlcrekqdatsarll
eqiladeethidyletqlqlmdklgdalyaaqcvsrppgsa

SCOPe Domain Coordinates for d3bkna_:

Click to download the PDB-style file with coordinates for d3bkna_.
(The format of our PDB-style files is described here.)

Timeline for d3bkna_: