SCOPe 2.01: Domain d3bk3b_: 3bk3 B:

Lineage for d3bk3b_ (3bk3 B:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)

6. Protein Bone morphogenetic protein-2 (BMP-2) [57516] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57517] (10 PDB entries)

8. Domain d3bk3b_: 3bk3 B: [172678]
   automated match to d3bmpa_

Details for d3bk3b_

PDB Entry: 3bk3, 2.7 Å

PDB Description: crystal structure of the complex of bmp-2 and the first von willebrand domain type c of crossveinless-2

PDB Compounds: (B:) Bone morphogenetic protein 2

SCOPe Domain Sequences for d3bk3b_:

Sequence; same for both SEQRES and ATOM records:

>d3bk3b_ g.17.1.2 (B:) Bone morphogenetic protein-2 (BMP-2) {Human (Homo sapiens) [TaxId: 9606]}
kssckrhplyvdfsdvgwndwivappgyhamychgecpfpladhlnstnhaivqtlvnsv
nskipkaccvptelsaismlmldenekvvlknyqdmvvegcgcr

Timeline for d3bk3b_:

• d3bk3b_ is new in SCOPe 2.01-stable
  
• d3bk3b_ appears in SCOPe 2.02
  
• d3bk3b_ appears in the current release, SCOPe 2.08