Lineage for d3bjaa_ (3bja A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479947Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1479948Protein automated matches [190154] (52 species)
    not a true protein
  7. 1479951Species Bacillus cereus [TaxId:222523] [188293] (2 PDB entries)
  8. 1479953Domain d3bjaa_: 3bja A: [172659]
    automated match to d2a61a1

Details for d3bjaa_

PDB Entry: 3bja (more details), 2.38 Å

PDB Description: crystal structure of putative marr-like transcription regulator (np_978771.1) from bacillus cereus atcc 10987 at 2.38 a resolution
PDB Compounds: (A:) Transcriptional regulator, MarR family, putative

SCOPe Domain Sequences for d3bjaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bjaa_ a.4.5.0 (A:) automated matches {Bacillus cereus [TaxId: 222523]}
gmnnrelygnirdvyhllqknldkaieqydisyvqfgviqvlaksgkvsmsklienmgcv
psnmttmiqrmkrdgyvmteknpndqretlvyltkkgeetkkqvdvqysdflkencgcft
keeegiledlllkwkkhln

SCOPe Domain Coordinates for d3bjaa_:

Click to download the PDB-style file with coordinates for d3bjaa_.
(The format of our PDB-style files is described here.)

Timeline for d3bjaa_: