SCOPe 2.01: Domain d3bfke_: 3bfk E:

Lineage for d3bfke_ (3bfk E:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (13 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [188290] (1 PDB entry)

8. Domain d3bfke_: 3bfk E: [172617]
   automated match to d1oiva_
   complexed with gdp, gol

Details for d3bfke_

PDB Entry: 3bfk, 1.8 Å

PDB Description: crystal structure of plasmodium falciparum rab11a in complex with gdp

PDB Compounds: (E:) Small GTPase Rab11

SCOPe Domain Sequences for d3bfke_:

Sequence, based on SEQRES records:

>d3bfke_ c.37.1.8 (E:) automated matches {Plasmodium falciparum [TaxId: 36329]}
dyydylfkivligdsgvgksnllsrftrdefnleskstigvefatksiqlknnkiikaqi
wdtagqeryraitsayyrgavgallvyditkknsfeniekwlkelrdnadsnivillvgn
ksdlkhlrvindndatqyakkeklafietsaleatnvelafhqllneiynv

Sequence, based on observed residues (ATOM records):

>d3bfke_ c.37.1.8 (E:) automated matches {Plasmodium falciparum [TaxId: 36329]}
dyydylfkivligdsgvgksnllsrftrdefnlgvefatksiqlkiikaqiwdtaraits
ayyrgavgallvyditkknsfeniekwlkelrdnadsnivillvgnksdlkhlrvindnd
atqyakkeklafietsaleatnvelafhqllneiynv

Timeline for d3bfke_:

• d3bfke_ is new in SCOPe 2.01-stable
  
• d3bfke_ appears in SCOPe 2.02
  
• d3bfke_ appears in the current release, SCOPe 2.08