Lineage for d3bfkd_ (3bfk D:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1163638Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1164515Protein automated matches [190047] (16 species)
    not a true protein
  7. 1164714Species Plasmodium falciparum [TaxId:36329] [188290] (1 PDB entry)
  8. 1164718Domain d3bfkd_: 3bfk D: [172616]
    automated match to d1oiva_
    complexed with gdp, gol

Details for d3bfkd_

PDB Entry: 3bfk (more details), 1.8 Å

PDB Description: crystal structure of plasmodium falciparum rab11a in complex with gdp
PDB Compounds: (D:) Small GTPase Rab11

SCOPe Domain Sequences for d3bfkd_:

Sequence, based on SEQRES records: (download)

>d3bfkd_ c.37.1.8 (D:) automated matches {Plasmodium falciparum [TaxId: 36329]}
dyydylfkivligdsgvgksnllsrftrdefnleskstigvefatksiqlknnkiikaqi
wdtagqeryraitsayyrgavgallvyditkknsfeniekwlkelrdnadsnivillvgn
ksdlkhlrvindndatqyakkeklafietsaleatnvelafhqllneiynvrq

Sequence, based on observed residues (ATOM records): (download)

>d3bfkd_ c.37.1.8 (D:) automated matches {Plasmodium falciparum [TaxId: 36329]}
dyydylfkivligdsgvgksnllsrftrdefnlgvefatksiqlnkiikaqiwdtaaits
ayyrgavgallvyditkknsfeniekwlkelrdnadsnivillvgnksdlkhlrvindnd
atqyakkeklafietsaleatnvelafhqllneiynvrq

SCOPe Domain Coordinates for d3bfkd_:

Click to download the PDB-style file with coordinates for d3bfkd_.
(The format of our PDB-style files is described here.)

Timeline for d3bfkd_: