SCOPe 2.06: Domain d3bfkb_: 3bfk B:

Lineage for d3bfkb_ (3bfk B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (29 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [188290] (1 PDB entry)

8. Domain d3bfkb_: 3bfk B: [172614]
   automated match to d1oiva_
   complexed with gdp, gol

Details for d3bfkb_

PDB Entry: 3bfk, 1.8 Å

PDB Description: crystal structure of plasmodium falciparum rab11a in complex with gdp

PDB Compounds: (B:) Small GTPase Rab11

SCOPe Domain Sequences for d3bfkb_:

Sequence; same for both SEQRES and ATOM records:

>d3bfkb_ c.37.1.8 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
yydylfkivligdsgvgksnllsrftrdefnleskstigvefatksiqlknnkiikaqiw
dtagqeryraitsayyrgavgallvyditkknsfeniekwlkelrdnadsnivillvgnk
sdlkhlrvindndatqyakkeklafietsaleatnvelafhqllneiynvrqkkqatkn

Timeline for d3bfkb_:

• d3bfkb_ first appeared in SCOPe 2.01
  
• d3bfkb_ appears in SCOPe 2.05
  
• d3bfkb_ appears in SCOPe 2.07
  
• d3bfkb_ appears in the current release, SCOPe 2.08