Lineage for d1ej3a_ (1ej3 A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97344Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 97345Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 97470Family a.39.1.5: Calmodulin-like [47502] (15 proteins)
  6. 97486Protein Calcium-regulated photoprotein [47512] (3 species)
  7. 97492Species Jellyfish (Aequorea aequorea), aequorin [TaxId:168712] [47513] (1 PDB entry)
  8. 97493Domain d1ej3a_: 1ej3 A: [17259]

Details for d1ej3a_

PDB Entry: 1ej3 (more details), 2.3 Å

PDB Description: crystal structure of aequorin

SCOP Domain Sequences for d1ej3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ej3a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin}
ltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkdav
eaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdqng
aitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpacek
lyggavp

SCOP Domain Coordinates for d1ej3a_:

Click to download the PDB-style file with coordinates for d1ej3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ej3a_: