Lineage for d3bfdb_ (3bfd B:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1949287Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1949998Protein automated matches [190161] (23 species)
    not a true protein
  7. 1950026Species Citrobacter sedlakii [TaxId:67826] [188289] (5 PDB entries)
  8. 1950032Domain d3bfdb_: 3bfd B: [172583]
    automated match to d1iyoa_
    complexed with cac; mutant

Details for d3bfdb_

PDB Entry: 3bfd (more details), 2 Å

PDB Description: crystal structure of the class a beta-lactamase sed-g238c mutant from citrobacter sedlakii
PDB Compounds: (B:) Class A beta-lactamase Sed1

SCOPe Domain Sequences for d3bfdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bfdb_ e.3.1.1 (B:) automated matches {Citrobacter sedlakii [TaxId: 67826]}
dvqqvqkklaalekqsggrlgvalintadnsqvlyraderfamcstskvmtaaavlkqse
thdgilqqkmtikkadltnwnpvtekyvgntmtlaelsaatlqysdntamnkllahlggp
gnvtafarsigdttfrldrkepelntaipgderdttsplamakslrkltlgdalagpqra
qlvdwlkgnttggqsiraglpahwvvgdktgacdygttndiaviwpedraplvlvtyftq
pqqdakwrkdvlaaaakivtegk

SCOPe Domain Coordinates for d3bfdb_:

Click to download the PDB-style file with coordinates for d3bfdb_.
(The format of our PDB-style files is described here.)

Timeline for d3bfdb_: