Lineage for d3bevb_ (3bev B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365383Species Chicken (Gallus gallus) [TaxId:9031] [188287] (25 PDB entries)
  8. 2365413Domain d3bevb_: 3bev B: [172577]
    automated match to d1hlam_

Details for d3bevb_

PDB Entry: 3bev (more details), 2.1 Å

PDB Description: 11mer structure of an mhc class i molecule from b21 chickens illustrate promiscuous peptide binding
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d3bevb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bevb_ b.1.1.0 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mdltpkvqvysrfpasagtknvlncfaagfhppkisitlmkdgvpmegaqysdmsfnddw
tfqrlvhadftpssgstyackvehetlkepqvykwdpef

SCOPe Domain Coordinates for d3bevb_:

Click to download the PDB-style file with coordinates for d3bevb_.
(The format of our PDB-style files is described here.)

Timeline for d3bevb_: