SCOP 1.71: Domain d2scpb_: 2scp B:

Lineage for d2scpb_ (2scp B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (10 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Sarcoplasmic calcium-binding protein [47509] (2 species)

7. Species Sandworm (Nereis diversicolor) [TaxId:126592] [47510] (2 PDB entries)

8. Domain d2scpb_: 2scp B: [17257]
   complexed with ca

Details for d2scpb_

PDB Entry: 2scp, 2 Å

PDB Description: structure of a sarcoplasmic calcium-binding protein from nereis diversicolor refined at 2.0 angstroms resolution

SCOP Domain Sequences for d2scpb_:

Sequence; same for both SEQRES and ATOM records:

>d2scpb_ a.39.1.5 (B:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor)}
sdlwvqkmktyfnridfdkdgaitrmdfesmaerfakesemkaehakvlmdsltgvwdnf
ltavaggkgidettfinsmkemvknpeaksvvegplplffravdtnednnisrdeygiff
gmlgldktmapasfdaidtnndgllsleefviagsdffmndgdstnkvfwgplv

Timeline for d2scpb_:

• d2scpb_ first appeared (with stable ids) in SCOP 1.55
  
• d2scpb_ appears in SCOP 1.69
  
• d2scpb_ appears in SCOP 1.73
  
• d2scpb_ appears in the current release, SCOPe 2.08