SCOPe 2.05: Domain d3bdxb_: 3bdx B:

Lineage for d3bdxb_ (3bdx B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries)

8. Domain d3bdxb_: 3bdx B: [172566]
   automated match to d1cd0a_
   complexed with act, gol, mes; mutant

Details for d3bdxb_

PDB Entry: 3bdx, 2.3 Å

PDB Description: crystal structure of the unstable and highly fibrillogenic pro7ser mutant of the recombinant variable domain 6ajl2

PDB Compounds: (B:) Amyloid lambda 6 light chain variable region PIP (fragment)

SCOPe Domain Sequences for d3bdxb_:

Sequence; same for both SEQRES and ATOM records:

>d3bdxb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfmltqshsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl

Timeline for d3bdxb_:

• d3bdxb_ first appeared in SCOPe 2.01
  
• d3bdxb_ appears in SCOPe 2.04
  
• d3bdxb_ appears in SCOPe 2.06
  
• d3bdxb_ appears in the current release, SCOPe 2.08