SCOPe 2.01: Domain d3bdia_: 3bdi A:

Lineage for d3bdia_ (3bdi A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (18 species)
   not a true protein

7. Species Thermoplasma acidophilum [TaxId:273075] [188276] (1 PDB entry)

8. Domain d3bdia_: 3bdi A: [172564]
   automated match to d1imja_
   complexed with peg

Details for d3bdia_

PDB Entry: 3bdi, 1.45 Å

PDB Description: crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution

PDB Compounds: (A:) Uncharacterized protein Ta0194

SCOPe Domain Sequences for d3bdia_:

Sequence; same for both SEQRES and ATOM records:

>d3bdia_ c.69.1.0 (A:) automated matches {Thermoplasma acidophilum [TaxId: 273075]}
gmalqeefidvngtrvfqrkmvtdsnrrsialfhgysftsmdwdkadlfnnyskigynvy
apdypgfgrsassekygidrgdlkhaaefirdylkangvarsvimgasmgggmvimttlq
ypdivdgiiavapawveslkgdmkkirqktllvwgskdhvvpialskeyasiisgsrlei
vegsghpvyiekpeefvritvdflrnl

Timeline for d3bdia_:

• d3bdia_ is new in SCOPe 2.01-stable
  
• d3bdia_ appears in SCOPe 2.02
  
• d3bdia_ appears in the current release, SCOPe 2.08, called d3bdia1