SCOPe 2.06: Domain d3bcqd_: 3bcq D:

Lineage for d3bcqd_ (3bcq D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (42 species)
   not a true protein

7. Species Brycon cephalus [TaxId:126311] [188621] (1 PDB entry)

8. Domain d3bcqd_: 3bcq D: [172549]
   automated match to d1spgb_
   complexed with hem, oxy

Details for d3bcqd_

PDB Entry: 3bcq, 2.4 Å

PDB Description: crystal structure of oxy-hemoglobin from brycon cephalus

PDB Compounds: (D:) Beta-chain hemoglobin

SCOPe Domain Sequences for d3bcqd_:

Sequence; same for both SEQRES and ATOM records:

>d3bcqd_ a.1.1.2 (D:) automated matches {Brycon cephalus [TaxId: 126311]}
vewstaersaiaglwgkisvdeigpqalsrllivypwtqrhfaafgnlsspaaingnpkv
ahhgkvvmggleraiknmdnikaaysslsvmhseklhvdpdnfrlladcitvcvamkfgp
saftpdvqeawqkflavvvaalsryh

Timeline for d3bcqd_:

• d3bcqd_ first appeared in SCOPe 2.01
  
• d3bcqd_ appears in SCOPe 2.05
  
• d3bcqd_ appears in SCOPe 2.07
  
• d3bcqd_ appears in the current release, SCOPe 2.08