Lineage for d1fi5a_ (1fi5 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442523Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 442524Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 442704Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 442946Protein Troponin C [47503] (6 species)
  7. 442975Species Chicken (Gallus gallus), cardiac isoform [TaxId:9031] [47507] (1 PDB entry)
  8. 442976Domain d1fi5a_: 1fi5 A: [17252]
    C-domain only

Details for d1fi5a_

PDB Entry: 1fi5 (more details)

PDB Description: nmr structure of the c terminal domain of cardiac troponin c bound to the n terminal domain of cardiac troponin i.

SCOP Domain Sequences for d1fi5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform}
mvrcmkddskgkteeelsdlfrmfdknadgyidleelkimlqatgetiteddieelmkdg
dknndgridydeflefmkgve

SCOP Domain Coordinates for d1fi5a_:

Click to download the PDB-style file with coordinates for d1fi5a_.
(The format of our PDB-style files is described here.)

Timeline for d1fi5a_: