Lineage for d3baba_ (3bab A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1432977Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1433387Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (5 families) (S)
    has a circularly permuted topology
  5. 1433403Family d.142.2.2: Adenylation domain of NAD+-dependent DNA ligase [56096] (2 proteins)
    automatically mapped to Pfam PF01653
  6. 1433404Protein Adenylation domain of NAD+-dependent DNA ligase [56097] (4 species)
    contains additional, N-terminal all-alpha subdomain
  7. 1433408Species Enterococcus faecalis [TaxId:1351] [118124] (8 PDB entries)
    Uniprot Q837V6 5-317
  8. 1433415Domain d3baba_: 3bab A: [172517]
    automated match to d1taea_
    complexed with 3bd, gol, nmn, so4

Details for d3baba_

PDB Entry: 3bab (more details), 2.5 Å

PDB Description: Structural Basis for the Inhibition of Bacterial NAD+ Dependent DNA Ligase
PDB Compounds: (A:) DNA ligase

SCOPe Domain Sequences for d3baba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3baba_ d.142.2.2 (A:) Adenylation domain of NAD+-dependent DNA ligase {Enterococcus faecalis [TaxId: 1351]}
ltltaattraqelrkqlnqysheyyvkdqpsvedyvydrlykelvdietefpdlitpdsp
tqrvggkvlsgfekaphdipmyslndgfskedifafdervrkaigkpvayccelkidgla
islryengvfvrgatrgdgtvgenitenlrtvrsvpmrltepisvevrgecympkqsfva
lneereengqdifanprnaaagslrqldtkivakrnlntflytvadfgpmkaktqfeale
elsaigfrtnperqlcqsidevwayieeyhekrstlpyeidgivikvnefalqdelgftv
kaprwaiaykfp

SCOPe Domain Coordinates for d3baba_:

Click to download the PDB-style file with coordinates for d3baba_.
(The format of our PDB-style files is described here.)

Timeline for d3baba_: