SCOPe 2.01: Domain d3ba2a_: 3ba2 A:

Lineage for d3ba2a_ (3ba2 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (53 PDB entries)

8. Domain d3ba2a_: 3ba2 A: [172513]
   automated match to d1azia_
   complexed with cyn, hkl, so4

Details for d3ba2a_

PDB Entry: 3ba2, 1.8 Å

PDB Description: Cyanide bound Chlorin substituted Myoglobin

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d3ba2a_:

Sequence; same for both SEQRES and ATOM records:

>d3ba2a_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq

Timeline for d3ba2a_:

• d3ba2a_ is new in SCOPe 2.01-stable
  
• d3ba2a_ appears in SCOPe 2.02
  
• d3ba2a_ appears in the current release, SCOPe 2.08