SCOPe 2.03: Domain d3b9vd_: 3b9v D:

Lineage for d3b9vd_ (3b9v D:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (75 PDB entries)

8. Domain d3b9vd_: 3b9v D: [172512]
   automated match to d1fvcb_

Details for d3b9vd_

PDB Entry: 3b9v, 1.8 Å

PDB Description: crystal structure of an autonomous vh domain

PDB Compounds: (D:) heavy chain variable domain

SCOPe Domain Sequences for d3b9vd_:

Sequence, based on SEQRES records:

>d3b9vd_ b.1.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgfnikdtyigwvrrapgkgeewvasiyptngytry
adsvkgrftisadtskntaylqmnslraedtavyycarwggdgfyamdywgqgtlvtvs

Sequence, based on observed residues (ATOM records):

>d3b9vd_ b.1.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgfnikdtyigwvrrapgkgeewvasiyptngytry
adsvkgrftisadtskntaylqmnslraedtavyycarwggfyamdywgqgtlvtvs

Timeline for d3b9vd_:

• d3b9vd_ first appeared in SCOPe 2.01
  
• d3b9vd_ appears in SCOPe 2.02
  
• d3b9vd_ appears in SCOPe 2.04
  
• d3b9vd_ appears in the current release, SCOPe 2.08