Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein CD8 [48734] (3 species) |
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [158864] (2 PDB entries) Uniprot P10300 22-136 |
Domain d3b9kf_: 3b9k F: [172511] Other proteins in same PDB: d3b9kc1, d3b9kc2, d3b9kl1, d3b9kl2 automated match to d2atpb1 complexed with nag |
PDB Entry: 3b9k (more details), 2.7 Å
SCOPe Domain Sequences for d3b9kf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b9kf_ b.1.1.1 (F:) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} liqtpssllvqtnhtakmscevksiskltsiywlrerqdpkdkyfeflaswssskgvlyg esvdkkrniilessdsrrpflsimnvkpedsdfyfcatvgspkmvfgtgtkltvvdv
Timeline for d3b9kf_: