SCOPe 2.06: Domain d3b8zb_: 3b8z B:

Lineage for d3b8zb_ (3b8z B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.0: automated matches [191495] (1 protein)
   not a true family

6. Protein automated matches [190805] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188286] (43 PDB entries)

8. Domain d3b8zb_: 3b8z B: [172501]
   automated match to d1r54a_
   complexed with 294, ca, zn

Details for d3b8zb_

PDB Entry: 3b8z, 1.4 Å

PDB Description: high resolution crystal structure of the catalytic domain of adamts-5 (aggrecanase-2)

PDB Compounds: (B:) protein ADAMTS-5

SCOPe Domain Sequences for d3b8zb_:

Sequence; same for both SEQRES and ATOM records:

>d3b8zb_ d.92.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srarqvelllvadasmarkygrglqhylltlasianrlyshasienhirlavvkvvvlgd
kdkslevsknaattlknfckwqhqhnqlgddheehydaailftredlcghhscdtlgmad
vgticsperscavieddglhaaftvaheighllglshddskfceetfgstedkrlmssil
tsidaskpwskctsatiteflddghgnclldlprkqi

Timeline for d3b8zb_:

• d3b8zb_ first appeared in SCOPe 2.01
  
• d3b8zb_ appears in SCOPe 2.05
  
• d3b8zb_ appears in SCOPe 2.07
  
• d3b8zb_ appears in the current release, SCOPe 2.08