Lineage for d3b8za_ (3b8z A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964873Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2964874Protein automated matches [190805] (20 species)
    not a true protein
  7. 2964907Species Human (Homo sapiens) [TaxId:9606] [188286] (69 PDB entries)
  8. 2964914Domain d3b8za_: 3b8z A: [172500]
    automated match to d1r54a_
    complexed with 294, ca, zn

Details for d3b8za_

PDB Entry: 3b8z (more details), 1.4 Å

PDB Description: high resolution crystal structure of the catalytic domain of adamts-5 (aggrecanase-2)
PDB Compounds: (A:) protein ADAMTS-5

SCOPe Domain Sequences for d3b8za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b8za_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srarqvelllvadasmarkygrglqhylltlasianrlyshasienhirlavvkvvvlgd
kdkslevsknaattlknfckwqhqhnqlgddheehydaailftredlcghhscdtlgmad
vgticsperscavieddglhaaftvaheighllglshddskfceetfgstedkrlmssil
tsidaskpwskctsatiteflddghgnclldlprkqi

SCOPe Domain Coordinates for d3b8za_:

Click to download the PDB-style file with coordinates for d3b8za_.
(The format of our PDB-style files is described here.)

Timeline for d3b8za_: