Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Vascular endothelial growth factor receptor 2 (kdr) [56160] (1 species) PTK group; PDGFR/VEGFR subfamily; membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56161] (30 PDB entries) |
Domain d3b8rb_: 3b8r B: [172499] Other proteins in same PDB: d3b8ra2 automated match to d1vr2a_ complexed with 887, edo |
PDB Entry: 3b8r (more details), 2.7 Å
SCOPe Domain Sequences for d3b8rb_:
Sequence, based on SEQRES records: (download)
>d3b8rb_ d.144.1.7 (B:) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} pydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlkegathsehr almselkilihighhlnvvnllgactkpggplmvitefckfgnlstylrskrnefvpykv apedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfgla rdiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgaspypgvk ideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllqa
>d3b8rb_ d.144.1.7 (B:) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} pydaskwefprdrlklgkplgrgqvieadafgidktatcrtvavkmlathsehralmsel kilihighhlnvvnllgactkpggplmvitefckfgnlstylrskrnefvpykykdfltl ehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfgllplkwmapetifd rvytiqsdvwsfgvllweifslgaspypgvkideefcrrlkegtrmrapdyttpemyqtm ldcwhgepsqrptfselvehlgnllqa
Timeline for d3b8rb_: