Lineage for d3b8hf_ (3b8h F:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1939878Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 1939879Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 1939880Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 1939966Protein Exotoxin A, C-terminal domain [56406] (1 species)
  7. 1939967Species Pseudomonas aeruginosa [TaxId:287] [56407] (9 PDB entries)
  8. 1939982Domain d3b8hf_: 3b8h F: [172495]
    Other proteins in same PDB: d3b8ha1, d3b8ha2, d3b8ha3, d3b8ha4, d3b8ha5, d3b8hc1, d3b8hc2, d3b8hc3, d3b8hc4, d3b8hc5, d3b8he1, d3b8he2, d3b8he3, d3b8he4, d3b8he5
    automated match to d1aera_
    protein/RNA complex; complexed with nad

Details for d3b8hf_

PDB Entry: 3b8h (more details), 2.5 Å

PDB Description: structure of the eef2-exoa(e546a)-nad+ complex
PDB Compounds: (F:) exotoxin a

SCOPe Domain Sequences for d3b8hf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b8hf_ d.166.1.1 (F:) Exotoxin A, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
aflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
aapeaageverlighplplrldaitgpaeeggrletilgwplaertvvipsaiptdprnv
ggdldpssipdkeqaisalpdyasqpg

SCOPe Domain Coordinates for d3b8hf_:

Click to download the PDB-style file with coordinates for d3b8hf_.
(The format of our PDB-style files is described here.)

Timeline for d3b8hf_: