Lineage for d3b8hd1 (3b8h D:400-605)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233860Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2233861Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2233862Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 2233948Protein Exotoxin A, C-terminal domain [56406] (1 species)
  7. 2233949Species Pseudomonas aeruginosa [TaxId:287] [56407] (9 PDB entries)
  8. 2233963Domain d3b8hd1: 3b8h D:400-605 [172494]
    Other proteins in same PDB: d3b8ha1, d3b8ha2, d3b8ha3, d3b8ha4, d3b8ha5, d3b8hb2, d3b8hc1, d3b8hc2, d3b8hc3, d3b8hc4, d3b8hc5, d3b8hd2, d3b8he1, d3b8he2, d3b8he3, d3b8he4, d3b8he5, d3b8hf2
    automated match to d1aera_
    protein/RNA complex; complexed with nad

Details for d3b8hd1

PDB Entry: 3b8h (more details), 2.5 Å

PDB Description: structure of the eef2-exoa(e546a)-nad+ complex
PDB Compounds: (D:) exotoxin a

SCOPe Domain Sequences for d3b8hd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b8hd1 d.166.1.1 (D:400-605) Exotoxin A, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
flgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrars
qdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltla
apeaageverlighplplrldaitgpaeeggrletilgwplaertvvipsaiptdprnvg
gdldpssipdkeqaisalpdyasqpg

SCOPe Domain Coordinates for d3b8hd1:

Click to download the PDB-style file with coordinates for d3b8hd1.
(The format of our PDB-style files is described here.)

Timeline for d3b8hd1: