Lineage for d3b8hb_ (3b8h B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1047603Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 1047604Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 1047605Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 1047689Protein Exotoxin A, C-terminal domain [56406] (1 species)
  7. 1047690Species Pseudomonas aeruginosa [TaxId:287] [56407] (12 PDB entries)
  8. 1047703Domain d3b8hb_: 3b8h B: [172493]
    automated match to d1aera_
    protein/RNA complex; complexed with nad

Details for d3b8hb_

PDB Entry: 3b8h (more details), 2.5 Å

PDB Description: structure of the eef2-exoa(e546a)-nad+ complex
PDB Compounds: (B:) exotoxin a

SCOPe Domain Sequences for d3b8hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b8hb_ d.166.1.1 (B:) Exotoxin A, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
aflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
aapeaageverlighplplrldaitgpaeeggrletilgwplaertvvipsaiptdprnv
ggdldpssipdkeqaisalpdyasqpg

SCOPe Domain Coordinates for d3b8hb_:

Click to download the PDB-style file with coordinates for d3b8hb_.
(The format of our PDB-style files is described here.)

Timeline for d3b8hb_: