Lineage for d3b84a_ (3b84 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1024736Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1024737Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1024851Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 1024852Protein automated matches [190710] (2 species)
    not a true protein
  7. 1024853Species Human (Homo sapiens) [TaxId:9606] [187857] (10 PDB entries)
  8. 1024854Domain d3b84a_: 3b84 A: [172486]
    automated match to d1r28a_
    complexed with edo, unk

Details for d3b84a_

PDB Entry: 3b84 (more details), 1.74 Å

PDB Description: crystal structure of the human btb domain of the krueppel related zinc finger protein 3 (hkr3)
PDB Compounds: (A:) Zinc finger and BTB domain-containing protein 48

SCOPe Domain Sequences for d3b84a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b84a_ d.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msfvqhsvrvlqelnkqrekgqycdatldvgglvfkahwsvlaccshffqslygdgsggs
vvlpagfaeifgllldffytghlaltsgnrdqvllaarelrvpeavelcqsfk

SCOPe Domain Coordinates for d3b84a_:

Click to download the PDB-style file with coordinates for d3b84a_.
(The format of our PDB-style files is described here.)

Timeline for d3b84a_: