SCOPe 2.08: Domain d3b84a1: 3b84 A:4-115

Lineage for d3b84a1 (3b84 A:4-115)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (54 PDB entries)

8. Domain d3b84a1: 3b84 A:4-115 [172486]
   Other proteins in same PDB: d3b84a2
   automated match to d1r28a_
   complexed with edo, unk

Details for d3b84a1

PDB Entry: 3b84, 1.74 Å

PDB Description: crystal structure of the human btb domain of the krueppel related zinc finger protein 3 (hkr3)

PDB Compounds: (A:) Zinc finger and BTB domain-containing protein 48

SCOPe Domain Sequences for d3b84a1:

Sequence; same for both SEQRES and ATOM records:

>d3b84a1 d.42.1.0 (A:4-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sfvqhsvrvlqelnkqrekgqycdatldvgglvfkahwsvlaccshffqslygdgsggsv
vlpagfaeifgllldffytghlaltsgnrdqvllaarelrvpeavelcqsfk

Timeline for d3b84a1:

• d3b84a1 first appeared in SCOPe 2.01, called d3b84a_
  
• d3b84a1 appears in SCOPe 2.07