Lineage for d3b83d_ (3b83 D:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1521239Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1521748Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 1521749Protein automated matches [190976] (2 species)
    not a true protein
  7. 1521766Species Human (Homo sapiens) [TaxId:9606] [188649] (27 PDB entries)
  8. 1521787Domain d3b83d_: 3b83 D: [172481]
    automated match to d1tena_

Details for d3b83d_

PDB Entry: 3b83 (more details), 2.4 Å

PDB Description: Computer-Based Redesign of a beta Sandwich Protein Suggests that Extensive Negative Design Is Not Required for De Novo beta Sheet Design.
PDB Compounds: (D:) ten-d3

SCOPe Domain Sequences for d3b83d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b83d_ b.1.2.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqppfnikvtnitlttavvtwqppilpiegilvtfgrkndpsdettvdltssitsltltn
lepnttyeirivarngqqysppvsttfttgs

SCOPe Domain Coordinates for d3b83d_:

Click to download the PDB-style file with coordinates for d3b83d_.
(The format of our PDB-style files is described here.)

Timeline for d3b83d_: