Lineage for d3b82d1 (3b82 D:400-605)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606368Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2606369Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2606370Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 2606456Protein Exotoxin A, C-terminal domain [56406] (1 species)
  7. 2606457Species Pseudomonas aeruginosa [TaxId:287] [56407] (9 PDB entries)
  8. 2606463Domain d3b82d1: 3b82 D:400-605 [172476]
    Other proteins in same PDB: d3b82a1, d3b82a2, d3b82a3, d3b82a4, d3b82a5, d3b82b2, d3b82c1, d3b82c2, d3b82c3, d3b82c4, d3b82c5, d3b82d2, d3b82e1, d3b82e2, d3b82e3, d3b82e4, d3b82e5, d3b82f2
    automated match to d1aera_
    protein/RNA complex; complexed with nad

Details for d3b82d1

PDB Entry: 3b82 (more details), 2.35 Å

PDB Description: structure of the eef2-exoa(e546h)-nad+ complex
PDB Compounds: (D:) exotoxin a

SCOPe Domain Sequences for d3b82d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b82d1 d.166.1.1 (D:400-605) Exotoxin A, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
flgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrars
qdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltla
apeaageverlighplplrldaitgpheeggrletilgwplaertvvipsaiptdprnvg
gdldpssipdkeqaisalpdyasqpg

SCOPe Domain Coordinates for d3b82d1:

Click to download the PDB-style file with coordinates for d3b82d1.
(The format of our PDB-style files is described here.)

Timeline for d3b82d1: