Lineage for d3b82d_ (3b82 D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1681419Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 1681420Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 1681421Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 1681507Protein Exotoxin A, C-terminal domain [56406] (1 species)
  7. 1681508Species Pseudomonas aeruginosa [TaxId:287] [56407] (9 PDB entries)
  8. 1681514Domain d3b82d_: 3b82 D: [172476]
    Other proteins in same PDB: d3b82a1, d3b82a2, d3b82a3, d3b82a4, d3b82a5, d3b82c1, d3b82c2, d3b82c3, d3b82c4, d3b82c5, d3b82e1, d3b82e2, d3b82e3, d3b82e4, d3b82e5
    automated match to d1aera_
    protein/RNA complex; complexed with nad

Details for d3b82d_

PDB Entry: 3b82 (more details), 2.35 Å

PDB Description: structure of the eef2-exoa(e546h)-nad+ complex
PDB Compounds: (D:) exotoxin a

SCOPe Domain Sequences for d3b82d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b82d_ d.166.1.1 (D:) Exotoxin A, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
aflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
aapeaageverlighplplrldaitgpheeggrletilgwplaertvvipsaiptdprnv
ggdldpssipdkeqaisalpdyasqpg

SCOPe Domain Coordinates for d3b82d_:

Click to download the PDB-style file with coordinates for d3b82d_.
(The format of our PDB-style files is described here.)

Timeline for d3b82d_: