| Class b: All beta proteins [48724] (174 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
| Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
| Protein automated matches [190135] (7 species) not a true protein |
| Species Rhodothermus marinus [TaxId:29549] [188274] (1 PDB entry) |
| Domain d3b7ma_: 3b7m A: [172466] automated match to d1h0ba_ mutant |
PDB Entry: 3b7m (more details), 2.1 Å
SCOPe Domain Sequences for d3b7ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b7ma_ b.29.1.11 (A:) automated matches {Rhodothermus marinus [TaxId: 29549]}
stvelcgqwdtrtvaggrytvsnnvwgaetaqcievgletgnftitraehdngnnvaayp
niqfaipqprrvqelsdvrtswtltpittgrwnaaydiffaanpnhvtysgdaelmiwln
kngdvmpigsrvatvelagatwevwyadngamnvisyvrttpttsvteldlkafiddava
rgyirpewyllsvqtgfelftggaglrsadfsvtvq
Timeline for d3b7ma_: