Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins) |
Protein Aminopeptidase [53205] (2 species) |
Species Aeromonas proteolytica [TaxId:671] [53206] (17 PDB entries) Uniprot Q01693 synonym: Vibrio proteolyticus |
Domain d3b7ia_: 3b7i A: [172458] automated match to d1ampa_ complexed with k, na, plu, scn, zn; mutant |
PDB Entry: 3b7i (more details), 1.75 Å
SCOPe Domain Sequences for d3b7ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b7ia_ c.56.5.4 (A:) Aminopeptidase {Aeromonas proteolytica [TaxId: 671]} mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacadhaswhnagypa ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg
Timeline for d3b7ia_: