SCOPe 2.05: Domain d3b78d_: 3b78 D:

Lineage for d3b78d_ (3b78 D:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)

6. Protein Exotoxin A, C-terminal domain [56406] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [56407] (9 PDB entries)

8. Domain d3b78d_: 3b78 D: [172452]
   Other proteins in same PDB: d3b78a1, d3b78a2, d3b78a3, d3b78a4, d3b78a5, d3b78c1, d3b78c2, d3b78c3, d3b78c4, d3b78c5, d3b78e1, d3b78e2, d3b78e3, d3b78e4, d3b78e5
   automated match to d1aera_
   protein/RNA complex; complexed with nad

Details for d3b78d_

PDB Entry: 3b78, 2.5 Å

PDB Description: structure of the eef2-exoa(r551h)-nad+ complex

PDB Compounds: (D:) exotoxin a

SCOPe Domain Sequences for d3b78d_:

Sequence; same for both SEQRES and ATOM records:

>d3b78d_ d.166.1.1 (D:) Exotoxin A, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
aflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
aapeaageverlighplplrldaitgpeeegghletilgwplaertvvipsaiptdprnv
ggdldpssipdkeqaisalpdyasqpg

Timeline for d3b78d_:

• d3b78d_ first appeared in SCOPe 2.01
  
• d3b78d_ appears in SCOPe 2.04
  
• d3b78d_ is called d3b78d1 in SCOPe 2.06
  
• d3b78d_ appears in the current release, SCOPe 2.08, called d3b78d1