SCOPe 2.05: Domain d3b3xa_: 3b3x A:

Lineage for d3b3xa_ (3b3x A:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (23 species)
   not a true protein

7. Species Bacillus licheniformis [TaxId:1402] [188244] (11 PDB entries)

8. Domain d3b3xa_: 3b3x A: [172422]
   automated match to d1i2wb_
   complexed with a33

Details for d3b3xa_

PDB Entry: 3b3x, 2.5 Å

PDB Description: Crystal structure of class A beta-lactamase of Bacillus licheniformis BS3 with aminocitrate

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3b3xa_:

Sequence; same for both SEQRES and ATOM records:

>d3b3xa_ e.3.1.1 (A:) automated matches {Bacillus licheniformis [TaxId: 1402]}
ddfakleeqfdaklgifaldtgtnrtvtyrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdntaqnlilkqiggpeslkkelr
kigdevtnperfepelnevnpgetqdtstaralatslqafaledklpsekrellidwmkr
nttgdaliragvpegwevadktgagsygtrndiaiiwppkgdpvvlavlssrdkkdakyd
dkliaeatkvvvkal

Timeline for d3b3xa_:

• d3b3xa_ first appeared in SCOPe 2.01
  
• d3b3xa_ appears in SCOPe 2.04
  
• d3b3xa_ appears in SCOPe 2.06
  
• d3b3xa_ appears in the current release, SCOPe 2.08